RAVER2 antibody

Name RAVER2 antibody
Supplier Fitzgerald
Catalog 70R-4637
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RAVER2 antibody was raised using the middle region of RAVER2 corresponding to a region with amino acids TITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYL
Purity/Format Affinity purified
Blocking Peptide RAVER2 Blocking Peptide
Description Rabbit polyclonal RAVER2 antibody raised against the middle region of RAVER2
Gene RAVER2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.