Name | ZNF33A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1951 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ZNF33A antibody was raised using the middle region of ZNF33A corresponding to a region with amino acids LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD |
Purity/Format | Affinity purified |
Blocking Peptide | ZNF33A Blocking Peptide |
Description | Rabbit polyclonal ZNF33A antibody raised against the middle region of ZNF33A |
Gene | ZNF33B |
Supplier Page | Shop |