ZNF33A antibody

Name ZNF33A antibody
Supplier Fitzgerald
Catalog 70R-1951
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ZNF33A antibody was raised using the middle region of ZNF33A corresponding to a region with amino acids LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD
Purity/Format Affinity purified
Blocking Peptide ZNF33A Blocking Peptide
Description Rabbit polyclonal ZNF33A antibody raised against the middle region of ZNF33A
Gene ZNF33B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.