| Name | EPX antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5444 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | EPX antibody was raised using the middle region of EPX corresponding to a region with amino acids LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP |
| Purity/Format | Affinity purified |
| Blocking Peptide | EPX Blocking Peptide |
| Description | Rabbit polyclonal EPX antibody raised against the middle region of EPX |
| Gene | EPX |
| Supplier Page | Shop |