| Name | ESRRA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1924 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN |
| Purity/Format | Affinity purified |
| Blocking Peptide | ESRRA Blocking Peptide |
| Description | Rabbit polyclonal ESRRA antibody raised against the N terminal of ESRRA |
| Gene | ESRRA |
| Supplier Page | Shop |