Name | TCAP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1249 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | TCAP antibody was raised using a synthetic peptide corresponding to a region with amino acids IQLQELLALETALGGQCVDRQEVAEITKQLPPVVPVSKPGALRRSLSRSM |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | TCAP Blocking Peptide |
Description | Rabbit polyclonal TCAP antibody |
Gene | TCAP |
Supplier Page | Shop |