RGS12 antibody

• Supplier: Fitzgerald
• Catalog: 70R-3110
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Mouse, Rat
• Antigen: RGS12 antibody was raised using the N terminal of RGS12 corresponding to a region with amino acids RSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRAGDQILAVNEI
• Purity/Format: Affinity purified
• Blocking Peptide: RGS12 Blocking Peptide
• Description: Rabbit polyclonal RGS12 antibody raised against the n terminal of RGS12
• Gene: RGS12