HYLS1 antibody

Name HYLS1 antibody
Supplier Fitzgerald
Catalog 70R-4391
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HYLS1 antibody was raised using the middle region of HYLS1 corresponding to a region with amino acids YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL
Purity/Format Affinity purified
Blocking Peptide HYLS1 Blocking Peptide
Description Rabbit polyclonal HYLS1 antibody raised against the middle region of HYLS1
Gene HYLS1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.