| Name | ACP5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3911 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ACP5 antibody was raised using the N terminal of ACP5 corresponding to a region with amino acids DNFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACP5 Blocking Peptide |
| Description | Rabbit polyclonal ACP5 antibody raised against the N terminal of ACP5 |
| Gene | ACP5 |
| Supplier Page | Shop |