MGC39633 antibody

Name MGC39633 antibody
Supplier Fitzgerald
Catalog 70R-1737
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human, Dog
Antigen MGC39633 antibody was raised using the N terminal Of Mgc39633 corresponding to a region with amino acids VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE
Purity/Format Total IgG Protein A purified
Blocking Peptide MGC39633 Blocking Peptide
Description Rabbit polyclonal MGC39633 antibody raised against the N terminal Of Mgc39633
Gene CCDC112
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.