| Name | MGC39633 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1737 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | MGC39633 antibody was raised using the N terminal Of Mgc39633 corresponding to a region with amino acids VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | MGC39633 Blocking Peptide |
| Description | Rabbit polyclonal MGC39633 antibody raised against the N terminal Of Mgc39633 |
| Gene | CCDC112 |
| Supplier Page | Shop |