Name | CRBN antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3211 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | CRBN antibody was raised using the N terminal of CRBN corresponding to a region with amino acids DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL |
Purity/Format | Affinity purified |
Blocking Peptide | CRBN Blocking Peptide |
Description | Rabbit polyclonal CRBN antibody raised against the N terminal of CRBN |
Gene | CRBN |
Supplier Page | Shop |