CRBN antibody

Name CRBN antibody
Supplier Fitzgerald
Catalog 70R-3211
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CRBN antibody was raised using the N terminal of CRBN corresponding to a region with amino acids DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
Purity/Format Affinity purified
Blocking Peptide CRBN Blocking Peptide
Description Rabbit polyclonal CRBN antibody raised against the N terminal of CRBN
Gene CRBN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.