| Name | ApoA-II antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3980 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ApoA-II antibody was raised using the N terminal of APOA2 corresponding to a region with amino acids MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
| Purity/Format | Affinity purified |
| Blocking Peptide | ApoA-II Blocking Peptide |
| Description | Rabbit polyclonal ApoA-II antibody raised against the N terminal of APOA2 |
| Gene | APOA2 |
| Supplier Page | Shop |