GCOM1 antibody

Name GCOM1 antibody
Supplier Fitzgerald
Catalog 70R-3275
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GCOM1 antibody was raised using the middle region of Gcom1 corresponding to a region with amino acids VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK
Purity/Format Affinity purified
Blocking Peptide GCOM1 Blocking Peptide
Description Rabbit polyclonal GCOM1 antibody raised against the middle region of Gcom1
Gene HHATL
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.