| Name | MIF4GD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4748 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MIF4GD antibody was raised using the N terminal of MIF4GD corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR |
| Purity/Format | Affinity purified |
| Blocking Peptide | MIF4GD Blocking Peptide |
| Description | Rabbit polyclonal MIF4GD antibody raised against the N terminal of MIF4GD |
| Gene | MIF4GD |
| Supplier Page | Shop |