| Name | LGICZ1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5201 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LGICZ1 antibody was raised using the N terminal Of Lgicz1 corresponding to a region with amino acids PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM |
| Purity/Format | Affinity purified |
| Blocking Peptide | LGICZ1 Blocking Peptide |
| Description | Rabbit polyclonal LGICZ1 antibody raised against the N terminal Of Lgicz1 |
| Gene | ZACN |
| Supplier Page | Shop |