| Name | EEF2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2318 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, C. elegans, Drosophila |
| Antigen | EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND |
| Purity/Format | Affinity purified |
| Blocking Peptide | EEF2 Blocking Peptide |
| Description | Rabbit polyclonal EEF2 antibody raised against the N terminal of EEF2 |
| Gene | EEF2 |
| Supplier Page | Shop |