Name | ACADL antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2543 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ACADL antibody was raised using the N terminal of ACADL corresponding to a region with amino acids MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR |
Purity/Format | Affinity purified |
Blocking Peptide | ACADL Blocking Peptide |
Description | Rabbit polyclonal ACADL antibody raised against the N terminal of ACADL |
Gene | ACADL |
Supplier Page | Shop |