| Name | ACADL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2543 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ACADL antibody was raised using the N terminal of ACADL corresponding to a region with amino acids MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIR |
| Purity/Format | Affinity purified |
| Blocking Peptide | ACADL Blocking Peptide |
| Description | Rabbit polyclonal ACADL antibody raised against the N terminal of ACADL |
| Gene | ACADL |
| Supplier Page | Shop |