| Name | PDIK1L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4177 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PDIK1L antibody was raised using the middle region of PDIK1L corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH |
| Purity/Format | Affinity purified |
| Blocking Peptide | PDIK1L Blocking Peptide |
| Description | Rabbit polyclonal PDIK1L antibody raised against the middle region of PDIK1L |
| Gene | PDIK1L |
| Supplier Page | Shop |