| Name | PGDS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2382 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKI |
| Purity/Format | Affinity purified |
| Blocking Peptide | PGDS Blocking Peptide |
| Description | Rabbit polyclonal PGDS antibody raised against the N terminal of PGDS |
| Gene | PTGDS |
| Supplier Page | Shop |