| Name | MGC33407 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4401 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MGC33407 antibody was raised using the middle region of MGC33407 corresponding to a region with amino acids DHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVASQSVLSVYAHGRVS |
| Purity/Format | Affinity purified |
| Blocking Peptide | MGC33407 Blocking Peptide |
| Description | Rabbit polyclonal MGC33407 antibody raised against the middle region of MGC33407 |
| Gene | ACTL9 |
| Supplier Page | Shop |