| Name | RGS9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5843 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RGS9 antibody was raised using the middle region of RGS9 corresponding to a region with amino acids LKSKRVANFFQIKMDVPTGSGTCLMDSEDAGTGESGDRATEKEVICPWES |
| Purity/Format | Affinity purified |
| Blocking Peptide | RGS9 Blocking Peptide |
| Description | Rabbit polyclonal RGS9 antibody raised against the middle region of RGS9 |
| Gene | RGS9 |
| Supplier Page | Shop |