SLC7A4 antibody

Name SLC7A4 antibody
Supplier Fitzgerald
Catalog 70R-6655
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLC7A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN
Purity/Format Affinity purified
Blocking Peptide SLC7A4 Blocking Peptide
Description Rabbit polyclonal SLC7A4 antibody
Gene SLC7A4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.