ALAD antibody

Name ALAD antibody
Supplier Fitzgerald
Catalog 70R-3446
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ALAD antibody was raised using the middle region of ALAD corresponding to a region with amino acids SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD
Purity/Format Affinity purified
Blocking Peptide ALAD Blocking Peptide
Description Rabbit polyclonal ALAD antibody raised against the middle region of ALAD
Gene ALAD
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.