| Name | WASF3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2676 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | WASF3 antibody was raised using the middle region of WASF3 corresponding to a region with amino acids RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS |
| Purity/Format | Affinity purified |
| Blocking Peptide | WASF3 Blocking Peptide |
| Description | Rabbit polyclonal WASF3 antibody raised against the middle region of WASF3 |
| Gene | WASF3 |
| Supplier Page | Shop |