| Name | TRIM45 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3060 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TRIM45 antibody was raised using the middle region of TRIM45 corresponding to a region with amino acids EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVP |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRIM45 Blocking Peptide |
| Description | Rabbit polyclonal TRIM45 antibody raised against the middle region of TRIM45 |
| Gene | TRIM45 |
| Supplier Page | Shop |