| Name | MUC3B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3253 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MUC3B antibody was raised using the N terminal of MUC3B corresponding to a region with amino acids KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI |
| Purity/Format | Affinity purified |
| Blocking Peptide | MUC3B Blocking Peptide |
| Description | Rabbit polyclonal MUC3B antibody raised against the N terminal of MUC3B |
| Gene | MUC3B |
| Supplier Page | Shop |