RASGRF1 antibody

• Supplier: Fitzgerald
• Catalog: 70R-5816
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: RASGRF1 antibody was raised using the N terminal of RASGRF1 corresponding to a region with amino acids RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG
• Purity/Format: Affinity purified
• Blocking Peptide: RASGRF1 Blocking Peptide
• Description: Rabbit polyclonal RASGRF1 antibody raised against the N terminal of RASGRF1
• Gene: RASGRF1