Name | MAT2A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4054 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | MAT2A antibody was raised using the middle region of MAT2A corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK |
Purity/Format | Affinity purified |
Blocking Peptide | MAT2A Blocking Peptide |
Description | Rabbit polyclonal MAT2A antibody raised against the middle region of MAT2A |
Gene | MAT2A |
Supplier Page | Shop |