| Name | MAT2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4054 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MAT2A antibody was raised using the middle region of MAT2A corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAT2A Blocking Peptide |
| Description | Rabbit polyclonal MAT2A antibody raised against the middle region of MAT2A |
| Gene | MAT2A |
| Supplier Page | Shop |