| Name | KIF3B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5560 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIF3B antibody was raised using the C terminal of KIF3B corresponding to a region with amino acids APKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSS |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIF3B Blocking Peptide |
| Description | Rabbit polyclonal KIF3B antibody raised against the C terminal of KIF3B |
| Gene | KIF3B |
| Supplier Page | Shop |