| Name | TMEM126B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1816 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TMEM126B antibody was raised using the middle region of TMEM126B corresponding to a region with amino acids VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | TMEM126B Blocking Peptide |
| Description | Rabbit polyclonal TMEM126B antibody raised against the middle region of TMEM126B |
| Gene | TMEM126B |
| Supplier Page | Shop |