GSPT2 antibody

Name GSPT2 antibody
Supplier Fitzgerald
Catalog 70R-5565
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GSPT2 antibody was raised using the N terminal of GSPT2 corresponding to a region with amino acids MALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVI
Purity/Format Affinity purified
Blocking Peptide GSPT2 Blocking Peptide
Description Rabbit polyclonal GSPT2 antibody raised against the N terminal of GSPT2
Gene GSTA1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.