CASD1 antibody

Name CASD1 antibody
Supplier Fitzgerald
Catalog 70R-7436
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen CASD1 antibody was raised using the N terminal of CASD1 corresponding to a region with amino acids MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE
Purity/Format Affinity purified
Blocking Peptide CASD1 Blocking Peptide
Description Rabbit polyclonal CASD1 antibody raised against the N terminal of CASD1
Gene CASD1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.