| Name | GRIK5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5212 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GRIK5 antibody was raised using the middle region of GRIK5 corresponding to a region with amino acids EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM |
| Purity/Format | Affinity purified |
| Blocking Peptide | GRIK5 Blocking Peptide |
| Description | Rabbit polyclonal GRIK5 antibody raised against the middle region of GRIK5 |
| Gene | GRIK5 |
| Supplier Page | Shop |