QRSL1 antibody

Name QRSL1 antibody
Supplier Fitzgerald
Catalog 70R-3579
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYSKQYREKRKQNPHSENEDSDWLITGGSSGGSAAAVSAFTCYAALGSDT
Purity/Format Affinity purified
Blocking Peptide QRSL1 Blocking Peptide
Description Rabbit polyclonal QRSL1 antibody
Gene QRSL1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.