Name | EHD4 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2681 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA |
Purity/Format | Affinity purified |
Blocking Peptide | EHD4 Blocking Peptide |
Description | Rabbit polyclonal EHD4 antibody raised against the middle region of EHD4 |
Gene | EHD4 |
Supplier Page | Shop |