Name | BCL7A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3771 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN |
Purity/Format | Affinity purified |
Blocking Peptide | BCL7A Blocking Peptide |
Description | Rabbit polyclonal BCL7A antibody raised against the middle region of BCL7A |
Gene | BCL7A |
Supplier Page | Shop |