BCL7A antibody

Name BCL7A antibody
Supplier Fitzgerald
Catalog 70R-3771
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPN
Purity/Format Affinity purified
Blocking Peptide BCL7A Blocking Peptide
Description Rabbit polyclonal BCL7A antibody raised against the middle region of BCL7A
Gene BCL7A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.