| Name | C17ORF82 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4283 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C17ORF82 antibody was raised using the N terminal Of C17Orf82 corresponding to a region with amino acids MGRPLEGQPLRALDLYPEPAFLRSGKDPKSSPASSPSFAVLGPEVRSTGG |
| Purity/Format | Affinity purified |
| Blocking Peptide | C17ORF82 Blocking Peptide |
| Description | Rabbit polyclonal C17ORF82 antibody raised against the N terminal Of C17Orf82 |
| Gene | C17orf82 |
| Supplier Page | Shop |