| Name | PP2447 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1269 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PP2447 antibody was raised using the N terminal Of Pp2447 corresponding to a region with amino acids MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PP2447 Blocking Peptide |
| Description | Rabbit polyclonal PP2447 antibody raised against the N terminal Of Pp2447 |
| Gene | TRABD |
| Supplier Page | Shop |