| Name | GAA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7147 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL |
| Purity/Format | Affinity purified |
| Blocking Peptide | GAA Blocking Peptide |
| Description | Rabbit polyclonal GAA antibody raised against the N terminal of GAA |
| Gene | GAA |
| Supplier Page | Shop |