| Name | HPD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2553 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HPD antibody was raised using the middle region of HPD corresponding to a region with amino acids EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV |
| Purity/Format | Affinity purified |
| Blocking Peptide | HPD Blocking Peptide |
| Description | Rabbit polyclonal HPD antibody raised against the middle region of HPD |
| Gene | HPD |
| Supplier Page | Shop |