| Name | KIFC2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5661 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIFC2 antibody was raised using the N terminal of KIFC2 corresponding to a region with amino acids TQGQQPLQLEEDQRAWQRLEQLILGQLEELKQQLEQQEEELGRLRLGVGA |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIFC2 Blocking Peptide |
| Description | Rabbit polyclonal KIFC2 antibody raised against the N terminal of KIFC2 |
| Gene | KIFC2 |
| Supplier Page | Shop |