| Name | MTTP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7339 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MTTP antibody was raised using the N terminal of MTTP corresponding to a region with amino acids MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK |
| Purity/Format | Affinity purified |
| Blocking Peptide | MTTP Blocking Peptide |
| Description | Rabbit polyclonal MTTP antibody raised against the N terminal of MTTP |
| Gene | MTTP |
| Supplier Page | Shop |