GLCCI1 antibody

Name GLCCI1 antibody
Supplier Fitzgerald
Catalog 70R-4571
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD
Purity/Format Affinity purified
Blocking Peptide GLCCI1 Blocking Peptide
Description Rabbit polyclonal GLCCI1 antibody raised against the middle region of GLCCI1
Gene GLCCI1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.