Name | CROT antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1109 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | CROT Blocking Peptide |
Description | Rabbit polyclonal CROT antibody raised against the N terminal of CROT |
Gene | MAP3K8 |
Supplier Page | Shop |