| Name | CROT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1109 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CROT Blocking Peptide |
| Description | Rabbit polyclonal CROT antibody raised against the N terminal of CROT |
| Gene | MAP3K8 |
| Supplier Page | Shop |