STK16 antibody

Name STK16 antibody
Supplier Fitzgerald
Catalog 70R-3483
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen STK16 antibody was raised using the middle region of STK16 corresponding to a region with amino acids TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL
Purity/Format Affinity purified
Blocking Peptide STK16 Blocking Peptide
Description Rabbit polyclonal STK16 antibody raised against the middle region of STK16
Gene STK16
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.