| Name | PIPOX antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6986 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PIPOX antibody was raised using the C terminal of PIPOX corresponding to a region with amino acids FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIPOX Blocking Peptide |
| Description | Rabbit polyclonal PIPOX antibody raised against the C terminal of PIPOX |
| Gene | PIPOX |
| Supplier Page | Shop |