Name | C19ORF24 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4955 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | C19ORF24 antibody was raised using the N terminal Of C19Orf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP |
Purity/Format | Affinity purified |
Blocking Peptide | C19ORF24 Blocking Peptide |
Description | Rabbit polyclonal C19ORF24 antibody raised against the N terminal Of C19Orf24 |
Gene | C19orf24 |
Supplier Page | Shop |