| Name | C19ORF24 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4955 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C19ORF24 antibody was raised using the N terminal Of C19Orf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP |
| Purity/Format | Affinity purified |
| Blocking Peptide | C19ORF24 Blocking Peptide |
| Description | Rabbit polyclonal C19ORF24 antibody raised against the N terminal Of C19Orf24 |
| Gene | C19orf24 |
| Supplier Page | Shop |