| Name | PWWP2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2969 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PWWP2B antibody was raised using the N terminal of PWWP2B corresponding to a region with amino acids ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS |
| Purity/Format | Affinity purified |
| Blocking Peptide | PWWP2B Blocking Peptide |
| Description | Rabbit polyclonal PWWP2B antibody raised against the N terminal of PWWP2B |
| Gene | PWWP2B |
| Supplier Page | Shop |