| Name | MRPL37 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2424 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MRPL37 antibody was raised using the N terminal of MRPL37 corresponding to a region with amino acids VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD |
| Purity/Format | Affinity purified |
| Blocking Peptide | MRPL37 Blocking Peptide |
| Description | Rabbit polyclonal MRPL37 antibody raised against the N terminal of MRPL37 |
| Gene | MRPL37 |
| Supplier Page | Shop |