| Name | WNT7B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6473 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | WNT7B antibody was raised using the middle region of WNT7B corresponding to a region with amino acids WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
| Purity/Format | Affinity purified |
| Blocking Peptide | WNT7B Blocking Peptide |
| Description | Rabbit polyclonal WNT7B antibody raised against the middle region of WNT7B |
| Gene | WNT7B |
| Supplier Page | Shop |